Rabbit Anti-FOXP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-15802P

• Product Name:
• Rabbit Anti-FOXP1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human FOXP1 aa 627-677. Sequence: MQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDM E

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Horse, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Xenopus tropicalis , Elephant

• Isotype:
• IgG

• Application:
• IHC-P, WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7 to 8

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid