Cat#:FPA-15615P;Product Name:Rabbit Anti-FNBP3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human FNBP3 aa 202-264. Sequence: SQTKESRWAKPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKQEEC TTTSTAPVPTTEI ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P, WB, ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;