Cat#:FPA-15476P;Product Name:Rabbit Anti-Flightless I Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Flightless I aa 425-475. The exact sequence is proprietary. (NP_002009.1). Sequence: ARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVR R ;Species Reactivity:Human Predicted to work with: Chimpanzee;Isotype:IgG;Application:IHC-P, WB, ICC/IF, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Flightless I Polyclonal Antibody
Online Inquiry
Cat#:
FPA-15476P
Product Name:
Rabbit Anti-Flightless I Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Synthetic peptide within Human Flightless I aa 425-475. The exact sequence is proprietary. (NP_002009.1). Sequence: ARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVR R