Rabbit Anti-FLCN Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-15466P

• Product Name:
• Rabbit Anti-FLCN Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human FLCN aa 1-50 (N terminal). The exact sequence is proprietary. NP_659434.2 . Sequence: MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEG

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Gorilla

• Isotype:
• IgG

• Application:
• ICC/IF, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid