Cat#:FPA-15264P;Product Name:Rabbit Anti-FH Polyclonal Antibody;Formulation:Lyophilised:Reconstitute by adding 1.0 ml sterile distilled water.;Host Species:Rabbit ;Immunogen:Full length native protein (purified) corresponding to Pig FH aa 1-466. ab182886 was isolated and purified from porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. Sequence: ASQDSFRIEYDTFGELKVPNDKYYGAQTVRSTMN;Species Reactivity:Pig Predicted to work with: Mouse, Rat, Human, Zebrafish, Cynomolgus monkey;Isotype:IgG;Application:WB, Dot blot;Storage Buffer:pH: 7.20 Constituent: 100% PBS No preservative added, as it may interfere with the antibody activity. No foreign protein added.;Storage Procedures:Shipped at Room Temperature. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;

Home > Products > Primary Antibodies >

Rabbit Anti-FH Polyclonal Antibody Online Inquiry

Cat#:
FPA-15264P

Product Name:
Rabbit Anti-FH Polyclonal Antibody

Formulation:
Lyophilised:Reconstitute by adding 1.0 ml sterile distilled water.

Host Species:
Rabbit

Immunogen:
Full length native protein (purified) corresponding to Pig FH aa 1-466. ab182886 was isolated and purified from porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. Sequence: ASQDSFRIEYDTFGELKVPNDKYYGAQTVRSTMN

Species Reactivity:
Pig Predicted to work with: Mouse, Rat, Human, Zebrafish, Cynomolgus monkey

Isotype:
IgG

Application:
WB, Dot blot

Storage Buffer:
pH: 7.20 Constituent: 100% PBS No preservative added, as it may interfere with the antibody activity. No foreign protein added.

Storage Procedures:
Shipped at Room Temperature. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.