Rabbit Anti-Ferritin Heavy Chain Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-15081P

• Product Name:
• Rabbit Anti-Ferritin Heavy Chain Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Ferritin Heavy Chain aa 108-157 (internal sequence). Sequence: EKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLR

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid