• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-FCGR1A Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-14996P
  • Product Name:
  • Rabbit Anti-FCGR1A Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human FCGR1A aa 100-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: IHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHW N
  • Species Reactivity:
  • Rat, Human Predicted to work with: Mouse
  • Isotype:
  • IgG
  • Application:
  • IHC-P, WB
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-FCGBP Polyclonal Antibody-FPA-14995P
  • Online Inquiry

    refresh