Rabbit Anti-FCGR1A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14996P

• Product Name:
• Rabbit Anti-FCGR1A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human FCGR1A aa 100-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: IHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHW N

• Species Reactivity:
• Rat, Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Clonality:
• Polyclonal

• Form:
• Liquid