Rabbit Anti-FBXO39 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14960P

• Product Name:
• Rabbit Anti-FBXO39 Polyclonal Antibody

• Formulation:
• FBXO39 is a member of the F-box protein family, which are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through t

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human FBXO39 aa 385-414 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: ILKSQKERQCALRVFKARIYTNRYETNEED

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal