Rabbit Anti-FBXL16 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14904P

• Product Name:
• Rabbit Anti-FBXL16 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 432-481 (CPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE) of Human FBXL16 (NP_699181).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid