Cat#:FPA-14874P;Product Name:Rabbit Anti-FBP2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Fusion protein corresponding to Human FBP2 aa 1-339. (Full length, BC113632). The identity of the protein fusion partner is GST. Sequence: MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVR KAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEEN KDAIITAKEKRGKY;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 50% Glycerol, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Fusion protein corresponding to Human FBP2 aa 1-339. (Full length, BC113632). The identity of the protein fusion partner is GST. Sequence: MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVR KAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEEN KDAIITAKEKRGKY