Rabbit Anti-FAM71D Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14695P

• Product Name:
• Rabbit Anti-FAM71D Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 288-337 ( TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISNI ) of Human FAM71D (NP_775797)

• Species Reactivity:
• Human Predicted to work with: Guinea pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid