Rabbit Anti-Fam212b Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14594P

• Product Name:
• Rabbit Anti-Fam212b Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 161-210 ( DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA ) of Rat Fam212b (NP_001101183).

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid