Cat#:FPA-14519P;Product Name:Rabbit Anti-FAM161B Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal aa 504 - 553 ( MDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQV ) of Human FAM161B (NP_689658) ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal aa 504 - 553 ( MDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQV ) of Human FAM161B (NP_689658)
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.