Rabbit Anti-Factor VIII Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14322P

• Product Name:
• Rabbit Anti-Factor VIII Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Factor VIII aa 80-130 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: IAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE G

• Species Reactivity:
• Human Predicted to work with: Mouse, Dog, Pig

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 0.01% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid