Rabbit Anti-Exonuclease 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-14168P

• Product Name:
• Rabbit Anti-Exonuclease 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Immunogen maps to a region within: LSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASI QK , corresponding to aa 725-775 of Human Exonuclease 1 (NP_006018.4).

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7-8

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid