• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Exonuclease 1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-14168P
  • Product Name:
  • Rabbit Anti-Exonuclease 1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Immunogen maps to a region within: LSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASI QK , corresponding to aa 725-775 of Human Exonuclease 1 (NP_006018.4).
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7-8
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Exonuclease 1 Polyclonal Antibody-FPA-14167P
  • Online Inquiry

    refresh