• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Estrogen Related Receptor gamma Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-14035P
  • Product Name:
  • Rabbit Anti-Estrogen Related Receptor gamma Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human Estrogen Related Receptor gamma aa 213-262 (internal sequence). Sequence: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
  • Species Reactivity:
  • Mouse, Human, Zebrafish Predicted to work with: Rat, Cow, Dog
  • Isotype:
  • IgG
  • Application:
  • ELISA, WB, IHC-P
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Estrogen Related Receptor beta Polyclonal Antibody-FPA-14034P
  • Online Inquiry

    refresh