Rabbit Anti-Eotaxin 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-13585P

• Product Name:
• Rabbit Anti-Eotaxin 3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Eotaxin 3 aa 31-80 (internal sequence). The exact sequence is proprietary. Sequence: KTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKW

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 40% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid