Cat#:FPA-13558P;Product Name:Rabbit Anti-ENTPD2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to a region within internal sequence aa 92 - 122 ( ASQSLVGCLEQALQDVPKERHAGTPLYLGAT ) of Human ENTPD2 (Q9Y5L3), conjugated to KLH. ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:Preservative: 0.09% Sodium Azide Constituents: PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.;
Synthetic peptide, corresponding to a region within internal sequence aa 92 - 122 ( ASQSLVGCLEQALQDVPKERHAGTPLYLGAT ) of Human ENTPD2 (Q9Y5L3), conjugated to KLH.