Rabbit Anti-ELMO3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-13312P

• Product Name:
• Rabbit Anti-ELMO3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ELMO3 aa 365-414. The exact sequence is proprietary. Sequence: TLALKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 98% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid