Rabbit Anti-E3 ubiquitin-protein ligase MUL1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-12709P

• Product Name:
• Rabbit Anti-E3 ubiquitin-protein ligase MUL1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 215-264 (GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYL Q) of Human C1orf166 (NP_078820)

• Species Reactivity:
• Mouse, Rat, Human Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB, ICC/IF, IHC-P

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid