Rabbit Anti-Dynein heavy chain Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46656P

• Product Name:
• Rabbit Anti-Dynein heavy chain Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human Dynein heavy chain aa 676-754. Sequence: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAM FSSRDFYRQLVANLELMANWYNKVMKTLL Database link: Q9NYC9 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid