Cat#:FPA-12545P;Product Name:Rabbit Anti-DYNC1I2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human DYNC1I2 aa 126-174. Sequence: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Orangutan;Isotype:IgG;Application:ICC/IF, IHC-P, WB;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;