• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-DOCK2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-12131P
  • Product Name:
  • Rabbit Anti-DOCK2 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human DOCK2 aa 500-550 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: EDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTLHDGFHDL V
  • Species Reactivity:
  • Mouse, Rat, Human
  • Isotype:
  • IgG
  • Application:
  • IHC-P
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-DOCK2 Polyclonal Antibody-FPA-12130P
  • Online Inquiry

    refresh