Rabbit Anti-DNA Polymerase gamma Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11967P

• Product Name:
• Rabbit Anti-DNA Polymerase gamma Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 242-291 ( QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ ) of Rat DNA Polymerase gamma (NP_445980).

• Species Reactivity:
• Rat, Human Predicted to work with: Mouse, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 97% PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid