Rabbit Anti-DNA Polymerase epsilon Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11961P

• Product Name:
• Rabbit Anti-DNA Polymerase epsilon Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the N terminal aa 1-50 (AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS C) of Human POLE3 (NP_059139).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid