Rabbit Anti-DIXDC1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11791P

• Product Name:
• Rabbit Anti-DIXDC1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human DIXDC1 aa 225-275. The exact sequence is proprietary. (NP_001033043.1). Sequence: PIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGT Y

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Chinese hamster, Orangutan

• Isotype:
• IgG

• Application:
• IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid