Cat#:FPA-11768P;Product Name:Rabbit Anti-DIS3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human DIS3 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: WVAPSSVVLHDEGQNEEDVEKEEETERMLK ;Species Reactivity:Mouse, Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human DIS3 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: WVAPSSVVLHDEGQNEEDVEKEEETERMLK