Rabbit Anti-Desmoglein 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11543P

• Product Name:
• Rabbit Anti-Desmoglein 3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Desmoglein 3 aa 50-90 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: EWVKFAKPCREGEDNSKRNPIAKITSDYQATQKITYRISGV

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Constituents: 0.01% BSA, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid