Rabbit Anti-Desmoglein 2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11540P

• Product Name:
• Rabbit Anti-Desmoglein 2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within the N terminal aa 72-121 ( KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE ) of Human Desmoglein 2, NP_001934.

• Species Reactivity:
• Cow, Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB, IHC-P, ICC/IF

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid