Rabbit Anti-DCDC2B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-11138P

• Product Name:
• Rabbit Anti-DCDC2B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human DCDC2B aa 74-123 (N terminal). The exact sequence is proprietary. (NP_001092904). Sequence: RGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQL

• Species Reactivity:
• Human Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid