Rabbit Anti-CysLT1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-10683P

• Product Name:
• Rabbit Anti-CysLT1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 199-248 (IIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFM P) of Human CysLT1 (NP_006630).

• Species Reactivity:
• Human Predicted to work with: Horse, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid