Cat#:FPA-10593P;Product Name:Rabbit Anti-CYP24A1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human CYP24A1 aa 360-410 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: LPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYAL P ;Species Reactivity:Mouse, Human Predicted to work with: Rat;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human CYP24A1 aa 360-410 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: LPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYAL P