Cat#:FPA-10366P;Product Name:Rabbit Anti-CXCL7 Polyclonal Antibody;Formulation:Lyophilised:Reconstitute in 200ul sterile water;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human NAP2 aa 45-112. Sequence: LAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEV IATLKDGRKI CLDPDAPR ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 98% PBS, 1% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;