Rabbit Anti-CSN5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46492P

• Product Name:
• Rabbit Anti-CSN5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• This product was produced with the following immunogens: Recombinant full length protein corresponding to Arabidopsis thaliana CSN5 aa 1-358. CSN5A. Sequence: MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWE NDPHYFKRVK ISALALLKMVVHARSGGTIEIMGLMQGKTDGDTI

• Species Reactivity:
• Arabidopsis thaliana, Plants

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• IgG fraction

• Storage Procedures:
• Preservative: 0.07% Sodium azide Constituents: 49% PBS, 50% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid