Rabbit Anti-CSN3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-10107P

• Product Name:
• Rabbit Anti-CSN3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Human CSN3 aa 1-182. this sequence corresponds to natural variant variant rs17850702. Swissprot: P07498 Sequence: MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY VPNSYPYYGTNLYQRRPAIAINNPCVPRTYYANPAVVRPHA

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.2 Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid