Cat#:FPA-9841P;Product Name:Rabbit Anti-CRAT Polyclonal Antibody;Formulation:Lyophilised:Reconstitute by adding 1.0 ml sterile distilled water.;Host Species:Rabbit ;Immunogen:Full length native protein (purified) corresponding to CRAT aa 1-627. Isolated and purified from pigeon breast muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. Sequence: MDRKQKQAEKARPYGLLKPAALGKIPGRFQLHQEALPHLPVP;Species Reactivity:Pigeon;Isotype:IgG;Application:ICC, WB, Dot blot, IHC-P, ELISA;Storage Buffer:pH: 7.20 Constituent: 100% PBS No preservative added, as it may interfere with the antibody activity. No foreign protein added.;Storage Procedures:Shipped at Room Temperature. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Store In the Dark.;

Home > Products > Primary Antibodies >

Rabbit Anti-CRAT Polyclonal Antibody Online Inquiry

Cat#:
FPA-9841P

Product Name:
Rabbit Anti-CRAT Polyclonal Antibody

Formulation:
Lyophilised:Reconstitute by adding 1.0 ml sterile distilled water.

Host Species:
Rabbit

Immunogen:
Full length native protein (purified) corresponding to CRAT aa 1-627. Isolated and purified from pigeon breast muscle. Freund’s complete adjuvant is used in the first step of the immunization procedure. Sequence: MDRKQKQAEKARPYGLLKPAALGKIPGRFQLHQEALPHLPVP

Species Reactivity:
Pigeon

Isotype:
IgG

Application:
ICC, WB, Dot blot, IHC-P, ELISA

Storage Buffer:
pH: 7.20 Constituent: 100% PBS No preservative added, as it may interfere with the antibody activity. No foreign protein added.

Storage Procedures:
Shipped at Room Temperature. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Store In the Dark.