Cat#:FPA-9658P;Product Name:Rabbit Anti-COX16 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human COX16 aa 70-105. Sequence: IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT ;Species Reactivity:Human Predicted to work with: Cow, Orangutan;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;