Rabbit Anti-COQ5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-9558P

• Product Name:
• Rabbit Anti-COQ5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 41-90 ( RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLG I) of Rat COQ5 (NP_001034111).

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid