Rabbit Anti-Connexin 59/GJA10 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-9509P

• Product Name:
• Rabbit Anti-Connexin 59/GJA10 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within aa 396 - 445 (DGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK G) of Human Connexin 59/GJA10 (NP_110399)

• Species Reactivity:
• Human Predicted to work with: Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid