Cat#:FPA-9491P;Product Name:Rabbit Anti-Connexin 40 / GJA5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Connexin 40/ GJA5 aa 21-70 (N terminal). The exact sequence is proprietary. Sequence: VGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAF ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Connexin 40/ GJA5 aa 21-70 (N terminal). The exact sequence is proprietary. Sequence: VGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAF
Species Reactivity:
Human Predicted to work with: Mouse, Rat
Isotype:
IgG
Application:
WB
Storage Buffer:
pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+ and Ca2+
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.