Rabbit Anti-COMMD1/MURR1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-9445P

• Product Name:
• Rabbit Anti-COMMD1/MURR1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C-terminal aa 110-159 ( MNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFL ) of Human COMMD1/MURR1 (NP_689729).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid