Rabbit Anti-COL18A1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-9320P

• Product Name:
• Rabbit Anti-COL18A1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human COL18A1 aa 1600-1650 conjugated to keyhole limpet haemocyanin. Sequence: ADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDEL L

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Aqueous buffered solution containing 100ug/ml BSA, 50% glycerol and 0.09% sodium azide.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid