Rabbit Anti-Coiled-coil domain-containing protein 111 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46443P

• Product Name:
• Rabbit Anti-Coiled-coil domain-containing protein 111 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human Coiled-coil domain-containing protein 111 aa 40-122. Sequence: SIWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFY YKSRKNLLHCYEVIPENAVCKLYFDLEFNKPAN Database link: Q96LW4 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Cow

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid