Cat#:FPA-9297P;Product Name:Rabbit Anti-COG3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human COG3 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: EGTPEIREHYLDSKKDVDRHLKSACEQFIQQ ;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99.91% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human COG3 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: EGTPEIREHYLDSKKDVDRHLKSACEQFIQQ