Cat#:FPA-9050P;Product Name:Rabbit Anti-CLNS1A Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human CLNS1A aa 187-237 (C terminal). The exact sequence is proprietary. (NP_001284.1). Sequence: RLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVD H ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Cow, Dog, Pig, Xenopus laevis, Chinese hamster, Orangutan;Isotype:IgG;Application:WB, IP, IHC-FoFr;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human CLNS1A aa 187-237 (C terminal). The exact sequence is proprietary. (NP_001284.1). Sequence: RLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVD H
Species Reactivity:
Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Cow, Dog, Pig, Xenopus laevis, Chinese hamster, Orangutan
Isotype:
IgG
Application:
WB, IP, IHC-FoFr
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: