Cat#:FPA-8966P;Product Name:Rabbit Anti-CLEC1B Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N-terminal aa 1-50 ( MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL ) of Mouse CLEC1B (NP_064369). ;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 97% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within N-terminal aa 1-50 ( MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL ) of Mouse CLEC1B (NP_064369).
Species Reactivity:
Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 97% PBS, 2% Sucrose
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.