Rabbit Anti-Claudin18 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-8904P

• Product Name:
• Rabbit Anti-Claudin18 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 143-192 ( LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM ) of Human Claudin18 (NP_001002026).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid