Cat#:FPA-8821P;Product Name:Rabbit Anti-CKMT2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human CKMT2 aa 231-280. Sequence: PVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Rabbit, Chicken, Cow, Orangutan;Isotype:IgG;Application:ICC/IF, WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+, Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;