Cat#:FPA-8613P;Product Name:Rabbit Anti-Chromodomain helicase DNA binding protein 5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Chromodomain helicase DNA binding protein 5 aa 1367-1412. The exact sequence is proprietary. Sequence: DNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLL ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.1% Sodium azide Constituents: 50% Glycerol, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Chromodomain helicase DNA binding protein 5 Polyclonal Antibody
Online Inquiry
Cat#:
FPA-8613P
Product Name:
Rabbit Anti-Chromodomain helicase DNA binding protein 5 Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Synthetic peptide within Human Chromodomain helicase DNA binding protein 5 aa 1367-1412. The exact sequence is proprietary. Sequence: DNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDKPLPPLL