Rabbit Anti-CHMP5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-8549P

• Product Name:
• Rabbit Anti-CHMP5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human CHMP5 aa 2-68 (N terminal). Sequence: NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKK MREGPAKNMVKQKALRV

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Orangutan, Xenopus tropicalis

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituent: 40% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid